Products

BMP-16 (Bone morphogenetic protein-16), Human

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. Originally discovered by their ability to induce the formation of bone and cartilage, BMPs are now considered to constitute a group of pivotal morphogenetic signals, orchestrating tissue architecture throughout the body. The important function of BMP signals is emphasized by the multitude of roles for dysregulated BMP signaling in pathological processes. The cancerous disease often involves misregulation of the BMP signaling system. BMP-16 protein, like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage.
No. Size Price Qty Status
C01077-5UG 5 ug $108.00 Inquiry
C01077-20UG 20 ug $268.00 Inquiry
C01077-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVD
NGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <2.2 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in 4 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 2 weeks under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Reviews for BMP-16 (Bone morphogenetic protein-16), Human

Average Rating: 0 (0 Reviews )